bioavailability is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2026-06-12. Where a claim depends on a specific study, the study is described rather than over-claimed.
SR9009 is often grouped with compounds studied for circadian and metabolic regulation rather than with classical anabolic steroids. Its interactions with nuclear receptors differ from those of androgen receptor ligands, and its proposed mechanisms involve transcriptional control rather than direct hormone signaling. Some sources classify it as a metabolic modulator because of observed effects on energy utilization. The distinction matters for regulation and for interpreting research results across different compound classes.
SR9009 is a synthetic small molecule developed as a REV-ERB agonist. It binds to REV-ERBα and REV-ERBβ, nuclear receptors that help regulate circadian rhythms and metabolic gene expression. In cell and animal studies, the compound alters lipid and glucose handling and influences skeletal muscle oxidative capacity. Its exact effects in humans remain largely uncharacterized because controlled clinical trials have not been reported. The molecule is frequently described in preclinical literature as a metabolic modulator.
Regulatory treatment of SR9009 varies by country and context. It is not approved as a therapeutic drug by agencies such as the United States Food and Drug Administration or the European Medicines Agency. Sports authorities list it as a prohibited substance; the World Anti-Doping Agency classifies it among hormone and metabolic modulators. Legal status for personal possession or sale differs across jurisdictions, and some countries may restrict it under analog or research chemical laws. Buyers who seek verified material often rely on independent laboratory testing because online product labels may not match contents.
Laboratory samples of SR9009 are typically handled as research chemicals rather than pharmaceuticals. Suppliers usually state that the material is for research use only and not for human or veterinary administration. Storage recommendations generally call for a freezer at approximately −20 °C, protection from light, and a desiccated environment. The solid is often described as a white to off-white powder. Solubility is commonly reported in organic solvents such as dimethyl sulfoxide and ethanol, with low solubility in water.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C20H24ClN3O4S | Reported for the free base |
| Molecular weight | 437.9 g/mol | Calculated from the formula |
| Primary target | REV-ERBα and REV-ERBβ | Nuclear receptors involved in circadian regulation |
| Solubility | Soluble in DMSO and ethanol | Poorly soluble in water |
| Typical storage | -20 °C, desiccated | Protect from light and moisture |
Stability depends on physical form, temperature, light exposure, and solvent. Solid SR9009 is generally stored cold and dry, with protection from light to limit degradation. Dimethyl sulfoxide stocks are common for laboratory work, but repeated freeze-thaw cycles can reduce compound integrity. Aqueous solutions may be less stable than organic stocks, and the ethyl ester in the structure can be susceptible to hydrolysis under certain conditions. Researchers typically validate storage conditions and recheck purity before quantitative experiments, especially when using archived material.
Regulatory treatment of SR9009 varies by country and region. It is not approved as a pharmaceutical, and several jurisdictions restrict its sale for human consumption. Some authorities classify it as a research chemical, a prescription-only substance, or a prohibited performance-enhancing agent in sport. Purchasers may encounter certificates of analysis, but these documents do not guarantee identity, purity, or legality. In research settings, institutional safety reviews and controlled procurement help ensure that materials are handled under appropriate oversight. The absence of harmonized rules means that legal status can change and requires verification.
Analytical identification of SR9009 typically relies on liquid chromatography coupled with tandem mass spectrometry. In biological samples, researchers first separate the compound from matrix components using protein precipitation, liquid-liquid extraction, or solid-phase extraction. High-performance liquid chromatography with ultraviolet detection and nuclear magnetic resonance spectroscopy can support structural confirmation of reference materials. Because SR9009 is a small, relatively lipophilic molecule, reverse-phase columns and acidic mobile phases are common. Laboratories often include isotope-labeled internal standards to improve quantification and to correct for ion suppression.
SR9009 is a synthetic small molecule studied as an agonist of the nuclear receptors REV-ERBα and REV-ERBβ. These receptors help regulate circadian rhythms and metabolic gene expression. In laboratory experiments, SR9009 binds these receptors and alters transcription of genes involved in lipid handling, glucose metabolism, and mitochondrial function. It is not a naturally occurring compound and has no approved therapeutic use. Research interest stems from its ability to modify energy metabolism in cells and animal models.
In rodent studies, SR9009 has been reported to increase mitochondrial content in skeletal muscle and improve exercise endurance under some conditions. These findings led to popular descriptions such as an exercise mimetic, although that term oversimplifies the biology. Effects vary by dose, timing, tissue, and model. The compound's influence on circadian pathways means that time of administration can matter in experiments. Whether similar metabolic changes occur in humans remains largely unexplored in controlled published trials.
Regulatory treatment of SR9009 reflects its investigational status. The compound has no approved human therapeutic indication, and sports authorities prohibit its use. It appears on anti-doping lists as a non-approved substance or metabolic modulator, depending on the list version. Products sold online as research chemicals are not quality-controlled medicines, so their identity and purity can differ from the label. Such products may also contain unlisted compounds, which complicates both testing and safety assessment.
Scientific discussion of SR9009 often separates animal evidence from human anecdote. Rodent studies provide controlled data on endurance, metabolism, and gene expression, but they use specific strains, doses, and treatment durations. Human reports are mostly uncontrolled and cannot establish cause and effect. Open questions include oral bioavailability, tissue distribution, metabolic stability, and long-term effects. Review articles generally call for more rigorous pharmacokinetic and safety research before any clinical use could be considered.
Analytical methods for SR9009 typically rely on liquid chromatography coupled with tandem mass spectrometry. The technique can separate the parent compound from related substances and detect low concentrations in biological matrices. Urine and blood are common samples in anti-doping testing, while in vitro studies may use cell culture media. Rapid metabolism and low expected concentrations make method validation important for reliable identification. Exact metabolite patterns can vary by species and are not fully mapped.
SR9009 is a synthetic small molecule that acts on the nuclear receptors REV-ERBα and REV-ERBβ. These receptors are part of the circadian clock machinery and normally repress transcription of certain target genes. In laboratory research, SR9009 is used as a chemical tool to study how REV-ERB activity influences metabolism, inflammation, and daily biological rhythms. The compound is not an approved medicine, and its effects in humans remain largely uncharacterized. It is often described as an investigational agent rather than a therapeutic product.
REV-ERB proteins typically suppress gene expression by recruiting corepressor complexes to DNA response elements. SR9009 binds these receptors and strengthens that repressive action in cell-based assays. Studies in rodents have reported changes in lipid handling, mitochondrial function, and exercise capacity after treatment. Such findings are often cited as evidence for metabolic effects, but species differences and limited pharmacokinetic data make direct translation to humans uncertain. Researchers continue to examine which effects are robust and which depend on specific experimental conditions.
SR9009 is frequently discussed alongside other REV-ERB ligands, including synthetic agonists and natural heme-related molecules. Its selectivity for REV-ERB over related nuclear receptors has been measured in binding and reporter assays, though off-target activity at higher concentrations is possible. The compound is prohibited in sport by the World Anti-Doping Agency, and it is not approved for any medical use in major jurisdictions. Products sold online may be labeled as research chemicals, and their identity and purity are not guaranteed by regulatory review.
Not much is known about the mutations in the genes OBS1and CCD8 and their function in growth and development so far. However, the implications of 3M syndrome suggest that both these genes encode for proteins that play a role in the CUL7 ubiquination pathway. Due to the fact that many of the abnormalities associated with this disorder are congenital, the presence of these clinical features at birth is usually sufficient to make the diagnosis. Diagnosis is suggested in children with the following: low birth weight, severe growth retardation, typical facial features, and characteristic radiological findings. In some cases, growth retardation and/or other characteristic findings suggestive of Three M syndrome may be detected before birth by ultrasound. In fetal ultrasonography, reflected sound waves are used to create an image of the developing fetus.
== Thallium-201 == Thallium-201 (201Tl) is a synthetic radioisotope of thallium. It has a half-life of 3.0421 days and decays by electron capture, emitting photons consisting mainly of K X-rays (~70–80 keV), and gammas of 135 and 167 keV (the latter stronger, emitted in 10% of decays). Thallium-201 is synthesized by the neutron activation of stable thallium in a nuclear reactor, or by the 203Tl(p, 3n)201Pb nuclear reaction in cyclotrons, as 201Pb then decays to 201Tl. It is a radiopharmaceutical, as it has fair imaging characteristics without excessive patient radiation dose. It was the most popular isotope used for nuclear cardiac stress tests. This nuclide has largely been replaced by technetium-99m, which has a shorter half-life (6 hours instead of 3 days) and a single high-energy photon peak (140 keV), which is better for imaging than the 3 energy peaks of thallium-201. Thallium-201 is now mostly used for myocardial viability studies. It will redistribute in body tissues, whereas Tc will not; Tl is taken up by the cardiac muscle via Na+/K+ pumps. Delayed imaging will show uptake in damaged but still living myocardial cells, which would appear as a scar with Tc or 82Rb.
Radioactive tracer isotopes are injected with hydraulic fracturing fluid to determine the injection profile and location of fractures created by hydraulic fracturing. Much smaller incidental doses of iodine-131 than those used in medical therapeutic procedures, are concluded by some studies to be the major cause of increased thyroid cancers after exposure to nuclear fission products. Other studies did not find a correlation.
== Etymology == The word sphinx comes from the Greek Σφίγξ, associated by folk etymology with the verb σφίγγω (sphíngō), meaning "to squeeze", "to tighten up". This name may be derived from the fact that lions kill their prey by strangulation, biting the throat of prey and holding them down until they die. However, the historian Susan Wise Bauer suggests that the word "sphinx" was instead a Greek corruption of the Egyptian name "shesepankh", which meant "living image", and referred rather to the statue of the sphinx, which was carved out of "living rock" (rock that was a contiguous part of the stony body of the Earth, shaped, but not cut away from its original source), than to the beast itself.
As a decentralized system, bitcoin operates without a central authority or single administrator, so that anyone can create a new bitcoin address and transact without needing any approval. This is accomplished through a specialized distributed ledger called a blockchain that records bitcoin transactions. The blockchain is implemented as an ordered list of blocks. Each block contains the hash of the previous block, made by hashing its header twice with SHA-256, chaining them in chronological order. The blockchain is maintained by a peer-to-peer network. Individual blocks, public addresses, and transactions within blocks are public information, and can be examined using a blockchain explorer. Nodes validate and broadcast transactions. Each node maintains a copy of the blockchain for ownership verification. A new block is created every 10 minutes on average, updating the blockchain across all nodes without central oversight. This process tracks bitcoin spending, ensuring each bitcoin is spent only once. Unlike a traditional ledger that tracks physical currency, bitcoins exist digitally as unspent outputs of transactions.
Sources: en.wikipedia.org
With both P-selectin and ICAM-1 on the substrate, cells attached and rolled, but the presence of ICAM-1 had no effect. However, if a neutrophil chemoattractant was added to the flow stream, it activated GPCR signaling, actin polymerization, and integrin-dependent firm adhesion to ICAM-1. Springer integrated these findings into the “three step paradigm” of leukocyte extravasation (diapedesis), which has become the standard framework for understanding leukocyte trafficking in inflammation. The laboratory of Eugene Butcher, including postdoctoral fellow Uli von Andrian, was working on emigration of leukocytes in vivo at the same time, and discovered that antibody to leukocyte integrins inhibited firm adhesion, but not rolling adhesion, to postcapillary venules at sites of inflammation. Butcher and Springer received the 2004 Crafoord Prize for this work. Springer's paradigm that integrins on leukocytes bind to counter-receptors with Ig-like domains on endothelium was later extended by others to integrin α4β1 binding to vascular cell adhesion molecule-1 (VCAM-1), which is inducible by inflammatory mediators on endothelium, and α4β7 binding to mucosal addressin cell adhesion molecule-1 (MAdCAM-1), which is constitutively expressed on mucosal endothelium. At the time that Springer described the three step model, no chemoattractants for peripheral blood lymphocytes that could stimulate emigration were known. Their existence was implied by the ability of pertussis toxin, which modifies the G protein Gαi subunit, to cause lymphocytosis in patients with whooping cough.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
==== History ==== Early measurements of thorium isomers were performed via gamma ray spectroscopy, producing the 29.5855 keV excited state of 229Th, and measuring the difference in emitted gamma ray energies as it decays to either the 229mTh (90%) or 229Th (10%) isomeric states. In 1976, Kroger and Reich sought to understand coriolis force effects in deformed nuclei, and attempted to match thorium's gamma-ray spectrum to theoretical nuclear shape models. To their surprise, the known nuclear states could not be reasonably classified into different total angular momentum quantization levels. They concluded that some states previously identified as 229Th actually arose from a spin-3/2 nuclear isomer, 229mTh, with a remarkably low excitation energy. At that time the energy was inferred to be below 100 eV, purely based on the non-observation of the isomer's direct decay. However, in 1990, further measurements led to the conclusion that the energy is almost certainly below 10 eV, making it one of the lowest known isomeric excitation energies. In the following years, the energy was further constrained to 3.5±1.0 eV, which was for a long time the accepted energy value. Improved gamma ray spectroscopy measurements using an advanced high-resolution X-ray microcalorimeter were carried out in 2007, yielding a new value for the transition energy of 7.6±0.5 eV, corrected to 7.8±0.5 eV in 2009. Earlier attempts to observe emitted photons had been doomed by a failure to consider two consequences of this higher energy:
== Patient population == The United States Food and Drug Administration and the European Medicines Agency have approved weight loss medications for adults with either a body-mass index (BMI) of at least 30, or a body-mass index of at least 27 with at least one weight-related comorbidity. This patient population is considered to have sufficiently high baseline health risks to justify the use of anti-obesity medication. The American Academy of Pediatrics had not previously supported the use of weight loss medication in adolescents but issued new guidelines in 2023, which recommend considering the use of weight loss medication in some overweight children aged 12 or older. The European Medicines Agency has approved semaglutide for children aged 12 or older who have a BMI in the 95 percentile for their age and a weight of at least 60 kilograms (130 lb). However, GLP-1 agonists may not be cost effective in this population.
Sources: en.wikipedia.org
Solvent extraction is used extensively in separation and purification processes. In its simplest form a reaction is performed in an organic solvent and unwanted by-products are removed by extraction into water at a particular pH. A metal ion may be extracted from an aqueous phase into an organic phase in which the salt is not soluble, by adding a ligand. The ligand, La−, forms a complex with the metal ion, Mb+, [MLx](b−ax)+ which has a strongly hydrophobic outer surface. If the complex has no electrical charge it will be extracted relatively easily into the organic phase. If the complex is charged, it is extracted as an ion pair. The additional ligand is not always required. For example, uranyl nitrate, UO2(NO3)2, is soluble in diethyl ether because the solvent itself acts as a ligand. This property was used in the past for separating uranium from other metals whose salts are not soluble in ether. Currently extraction into kerosene is preferred, using a ligand such as tri-n-butyl phosphate, TBP. In the PUREX process, which is commonly used in nuclear reprocessing, uranium(VI) is extracted from strong nitric acid as the electrically neutral complex [UO2(TBP)2(NO3)2]. The strong nitric acid provides a high concentration of nitrate ions which pushes the equilibrium in favour of the weak nitrato complex. Uranium is recovered by back-extraction (stripping) into weak nitric acid. Plutonium(IV) forms a similar complex, [PuO2(TBP)2(NO3)2] and the plutonium in this complex can be reduced to separate it from uranium.
== Welfare considerations during farmed insect rearing == As with other livestock animals, a variety of welfare concerns can manifest during the rearing and slaughter of insects. The 5 Domains framework can be used to broadly categorize these areas of possible concern into four functional domains (nutrition, environment, behavior, and physical health) which then influence the mental domain of the animal's welfare state. As the insect industry is very new, and there are few animal welfare scientists dedicated to studying its livestock, there is little guidance or infrastructure dedicated to improving farmed insect welfare. Further, just as with farmed vertebrates, species-specific guidance is needed to maintain high welfare for each species of insects that is farmed. Recently, several comprehensive and open access review papers have been published that cover the likely welfare concerns for black soldier flies (Hermetia illucens), yellow mealworms (Tenebrio molitor), and three species of farmed crickets (Acheta domesticus, Gryllus bimaculatus, Gryllodes sigillatus), as well as some work on the housefly (Musca domestica). The major, currently known areas of welfare concern during rearing are organized below by functional domain and largely focus on the most farmed insects: black soldier flies, yellow mealworms, and farmed crickets.
Conventional insulin therapy is a therapeutic regimen for treatment of diabetes mellitus which contrasts with the newer intensive insulin therapy. This older method (prior to the development of home blood glucose monitoring) is still in use in a proportion of cases.
Sources: en.wikipedia.org
It is a synthetic REV-ERB agonist used mainly in preclinical research. It is not an approved medicine for human use.
It binds to REV-ERBα and REV-ERBβ, nuclear receptors involved in circadian and metabolic gene regulation. This can alter transcription of genes related to lipid and glucose metabolism in experimental models.
No controlled human trials have established that effect. Endurance findings come primarily from rodent studies, and human responses remain unknown.
Legality depends on the country and the intended use. In many places it is sold as a research chemical, but sports and medicine regulations restrict it.